Basic Information

Insect: Apolygus lucorum
Gene Symbol: lola
Assembly: GCA_009739505.2
Location: CM019169.2:27732976-27745830[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 5.7e-07 4.8e-05 23.7 1.4 1 21 8 28 8 29 0.96

2 8 2.2e-06 0.00018 21.9 0.3 2 22 38 58 37 58 0.95

3 8 0.091 7.5 7.4 0.6 1 22 59 81 59 81 0.91

4 8 0.00019 0.016 15.8 1.1 1 22 89 110 89 112 0.89

5 8 7.5e-05 0.0062 17.0 3.0 1 20 132 151 132 153 0.96

6 8 4.2e-05 0.0035 17.9 2.2 1 23 161 184 161 184 0.94

7 8 0.00031 0.025 15.1 0.2 5 21 225 241 218 242 0.84

8 8 0.00075 0.062 13.9 1.1 1 23 250 273 250 273 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	5.7e-07	4.8e-05	23.7	1.4	1	21	8	28	8	29	0.96
2	8	2.2e-06	0.00018	21.9	0.3	2	22	38	58	37	58	0.95
3	8	0.091	7.5	7.4	0.6	1	22	59	81	59	81	0.91
4	8	0.00019	0.016	15.8	1.1	1	22	89	110	89	112	0.89
5	8	7.5e-05	0.0062	17.0	3.0	1	20	132	151	132	153	0.96
6	8	4.2e-05	0.0035	17.9	2.2	1	23	161	184	161	184	0.94
7	8	0.00031	0.025	15.1	0.2	5	21	225	241	218	242	0.84
8	8	0.00075	0.062	13.9	1.1	1	23	250	273	250	273	0.91

Sequence Information

Coding Sequence: ATGTTCCTCCCAGGTTCACGCTACGTGTGCCCGCAATGCGGCCGCAGCTACAAACACAACTTCACCCTCAATCGCCACATCCGCTACGAATGCGGGAAGAAACCCGGGATTCCGTGCCCGCTCTGTCACCAGACGTTCAAGAACAGGGCCGCCCTACAGAGCCACATGAGAAGGTTTTTGTGCCCCAAATGTCGTCAGCGTTCCTACAAGTCTGTCGGTAGTTTGAATCAGCACCTAAAACGTGAGTGCGGGAAAGATCCGCAGTTCGCTTGCCCTTTCTGCGATTTTAGATCCAAGCAAAAGAGCAACCTCAAATCCCACGTGGGCCTCAAGCACACTGACCCGCTCAACTTCGACGCTGTGACAGCTTTCTTGCGCAAAAAAGTTCCCCGGTACTCCTGTTACAAATGCGGCCGCGTCTACAAACACAAATACACCTTAAACAGCCATTTAACCTTCGAGTGCGGTAAAGAGCCTAAATTCACCTGCACGTACTGCCCCTACAAGTCAAAAGTGAAAAGCAACCTCAAGAAACACGTGCTTCTCAAACACTTGTCCAATTTGGACATCAAGGATGTCGCCGGAGCAACGAAGTGGCTGAAGACTGAGGAAACCCAGCAGTTATTTGACTTCTCTCAGAACTCGATGGACTTCTGCGAAGTGCAGCTGGCAAATTGCGGCCGATCGTACAAGTACAAGAACAATCTGAAGGCTCATCAGTTGCGCGAATGTGGCAAAGACCCGAGGTTTCTCTGCCCCCAGTGCCCTTACAGGTCGAAAGTTAAAAGCAACATGAAGAAACATATTTTCCTCCAACACTATTCCCAAACCGTCGCTCTTTGA
Protein Sequence: MFLPGSRYVCPQCGRSYKHNFTLNRHIRYECGKKPGIPCPLCHQTFKNRAALQSHMRRFLCPKCRQRSYKSVGSLNQHLKRECGKDPQFACPFCDFRSKQKSNLKSHVGLKHTDPLNFDAVTAFLRKKVPRYSCYKCGRVYKHKYTLNSHLTFECGKEPKFTCTYCPYKSKVKSNLKKHVLLKHLSNLDIKDVAGATKWLKTEETQQLFDFSQNSMDFCEVQLANCGRSYKYKNNLKAHQLRECGKDPRFLCPQCPYRSKVKSNMKKHIFLQHYSQTVAL

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -