Basic Information

Transcription Factor Domain

TF Family: THAP
Domain: THAP domain
PFAM: PF05485
TF Group: Zinc-Coordinating Group
Description: The THAP domain is a putative DNA-binding domain (DBD) and probably also binds a zinc ion. It features the conserved C2CH architecture (consensus sequence: Cys - 2-4 residues - Cys - 35-50 residues - Cys - 2 residues - His). Other universal features include the location of the domain at the N-termini of proteins, its size of about 90 residues, a C-terminal AVPTIF box and several other conserved residues. Orthologues of the human THAP domain have been identified in other vertebrates and probably worms and flies, but not in other eukaryotes or any prokaryotes [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 5.6e-20 1.5e-16 61.5 1.4 1 87 5 98 5 98 0.87

2 3 3 8.3e+03 -1.8 0.1 40 40 120 120 102 136 0.43

3 3 0.17 4.7e+02 2.2 0.1 1 37 139 169 139 185 0.66

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	5.6e-20	1.5e-16	61.5	1.4	1	87	5	98	5	98	0.87
2	3	3	8.3e+03	-1.8	0.1	40	40	120	120	102	136	0.43
3	3	0.17	4.7e+02	2.2	0.1	1	37	139	169	139	185	0.66

Coding Sequence: ATGCCAAGACGTTGCTGTATTCCTGGCTGTAAGGGAAATTACGACAGTActttgaaatcaaataattatgcttctgttttcctctttccaaagaatgaagaattgagaaaaaaatggtTAGCTGCTATTCCTAGAAAAAATTGGTCTCCTACAAAATATTCTGCAGTTTGTAGTTTTCATTTTGctgaaaatgatattcaaaGATATGAGAAAATTGTATGTActaataatacaattgaaaatgttttattgtGTCGTCCAAAGCTTGTAGAGAATGCAGTACCTTCTATTTTTCCTAATGTGTCAACTTATTCAAGACACGAAACTAAAAAAACCTTTTATTCAAGACTGAAacgtagaaaaaatttcaaagaacatAATTATTCCAAACAACAAGTTATTCCAAATGATGAATGTTTAGTCCAAGAATgtaataaaatttcttttcatgaaTTAAAATGGGTATTACCTGGTGATATGAAATTATCCAGGTGGTACcaacttcaaaatttattgacaTGGTATAAATCTACACCTGATGTACCTGATAGtgatgaaataattcttattgaataa
Protein Sequence: MPRRCCIPGCKGNYDSTLKSNNYASVFLFPKNEELRKKWLAAIPRKNWSPTKYSAVCSFHFAENDIQRYEKIVCTNNTIENVLLCRPKLVENAVPSIFPNVSTYSRHETKKTFYSRLKRRKNFKEHNYSKQQVIPNDECLVQECNKISFHELKWVLPGDMKLSRWYQLQNLLTWYKSTPDVPDSDEIILIE

Sequence clustering based on sequence similarity using MMseqs2