Basic Information

Insect: Aphrophora alni
Gene Symbol: -
Assembly: GCA_963513935.1
Location: OY740777.1:38739477-38740418[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 1.4 4.8e+02 3.8 4.8 1 23 3 27 3 27 0.88

2 10 0.00019 0.063 16.0 0.7 1 23 63 85 63 85 0.98

3 10 2e-05 0.0066 19.1 1.3 1 23 91 114 91 114 0.97

4 10 8.8e-06 0.003 20.2 1.7 1 23 120 142 120 142 0.98

5 10 1.4e-05 0.0046 19.6 2.8 1 23 148 170 148 170 0.99

6 10 8.6e-06 0.0029 20.3 0.4 1 23 176 198 176 198 0.98

7 10 3.3e-06 0.0011 21.5 1.9 1 23 204 226 204 226 0.99

8 10 0.036 12 8.9 0.8 2 23 231 252 230 252 0.95

9 10 0.00078 0.26 14.1 0.1 1 23 258 280 258 280 0.98

10 10 0.0007 0.24 14.2 0.7 1 23 286 309 286 309 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	1.4	4.8e+02	3.8	4.8	1	23	3	27	3	27	0.88
2	10	0.00019	0.063	16.0	0.7	1	23	63	85	63	85	0.98
3	10	2e-05	0.0066	19.1	1.3	1	23	91	114	91	114	0.97
4	10	8.8e-06	0.003	20.2	1.7	1	23	120	142	120	142	0.98
5	10	1.4e-05	0.0046	19.6	2.8	1	23	148	170	148	170	0.99
6	10	8.6e-06	0.0029	20.3	0.4	1	23	176	198	176	198	0.98
7	10	3.3e-06	0.0011	21.5	1.9	1	23	204	226	204	226	0.99
8	10	0.036	12	8.9	0.8	2	23	231	252	230	252	0.95
9	10	0.00078	0.26	14.1	0.1	1	23	258	280	258	280	0.98
10	10	0.0007	0.24	14.2	0.7	1	23	286	309	286	309	0.97

Sequence Information

Coding Sequence: ATGCTGTTTCTCTGCGGAAAATGTGGCAGTAAGTGCACTCAAATTGATGAATATCATGATCAcataaaaatatgttcacattCAATAACATCAACATTACATTTAGGCAATAGTACTGGGGAAAGTAATCATTTTAAAGGAACAAGGGATGTTAATAGCCATGTTAAATTGCCAACTGGTAAACCATACAAGTGTAAAGAATGTGACTATTCTGCTTCACTATTAAGTGATCTTAAAACACACTCAAAAATACATTATCGAAAGAAACTGTATACATGTTCACAATGTGATTATACCGTTTCAAAATCATGGAATCTTAAAAGACATACTATAAAAATGCATAATAGAGAGAAACTGTACAAGTGTACTGAATGTGATTATGCTGCTTCTCAAACCTCTCATCTTAAAACACACATGACGGTACATACAGGAGAAAAGTTGTATAAATGTGCTGATTGTAACTATACTACTTCACGTAGAAGTGATTTGTATAAACACAAAAGCAcccacactggagaaaaaccttacAAATGTACTGAATGTGATTATTCTACTGCACGACAAAATGACGTTCAAAGGCACATGGTAGTACATACAGAAACAACTCGATATAAGTGTAAAGAATGTGAATATACGTCTTCGAGACGAAATGAACTTTTAAAGCATATGAGAGAACATAAAAAGCCTTTAAACTGTACAGAGTGTAAGTATACTGCTTTAAGACGAAATGACCTCGAAAGACATTTCAGAGTTCATACAGGCGATAAACCTTATCCTTGTACAttatgtgattattctgcttcacTATTAGGTACACTAAAAGCACACATGACAATTCACACTGGAATCAAACCTTATAAATGTACAGAATGTAATTTTTCTGCGTCTGTTAGTATCAATGTTAAAAGACATTTAAGAGAAAGGCATTCTATTAATCTTTAA
Protein Sequence: MLFLCGKCGSKCTQIDEYHDHIKICSHSITSTLHLGNSTGESNHFKGTRDVNSHVKLPTGKPYKCKECDYSASLLSDLKTHSKIHYRKKLYTCSQCDYTVSKSWNLKRHTIKMHNREKLYKCTECDYAASQTSHLKTHMTVHTGEKLYKCADCNYTTSRRSDLYKHKSTHTGEKPYKCTECDYSTARQNDVQRHMVVHTETTRYKCKECEYTSSRRNELLKHMREHKKPLNCTECKYTALRRNDLERHFRVHTGDKPYPCTLCDYSASLLGTLKAHMTIHTGIKPYKCTECNFSASVSINVKRHLRERHSINL

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -