Aaln087751.1
Basic Information
- Insect
- Aphrophora alni
- Gene Symbol
- -
- Assembly
- GCA_963513935.1
- Location
- OY740779.1:16490399-16492426[+]
Transcription Factor Domain
- TF Family
- MH1
- Domain
- MH1 domain
- PFAM
- PF03165
- TF Group
- Unclassified Structure
- Description
- The MH1 (MAD homology 1) domain is found at the amino terminus of MAD related proteins such as Smads. This domain is separated from the MH2 domain by a non-conserved linker region. The crystal structure of the MH1 domain shows that a highly conserved 11 residue beta hairpin is used to bind the DNA consensus sequence GNCN in the major groove, shown to be vital for the transcriptional activation of target genes. Not all examples of MH1 can bind to DNA however. Smad2 cannot bind DNA and has a large insertion within the hairpin that presumably abolishes DNA binding. A basic helix (H2) in MH1 with the nuclear localisation signal KKLKK has been shown to be essential for Smad3 nuclear import. Smads also use the MH1 domain to interact with transcription factors such as Jun, TFE3, Sp1, and Runx [2, 1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 17 0.26 3.5e+03 0.6 0.0 50 73 15 38 7 46 0.81 2 17 0.25 3.3e+03 0.6 0.0 44 72 57 85 46 100 0.77 3 17 0.2 2.7e+03 0.9 0.0 42 70 103 131 93 147 0.82 4 17 1.1 1.4e+04 -1.4 0.0 56 71 161 176 135 204 0.64 5 17 0.52 7e+03 -0.4 0.0 51 71 204 224 187 230 0.77 6 17 0.099 1.3e+03 1.9 0.0 40 73 321 354 300 358 0.77 7 17 0.17 2.3e+03 1.1 0.0 42 71 339 368 328 378 0.62 8 17 0.27 3.6e+03 0.5 0.0 44 72 357 385 349 392 0.67 9 17 0.19 2.6e+03 1.0 0.0 42 71 371 400 362 408 0.67 10 17 0.079 1.1e+03 2.2 0.0 45 80 406 441 395 452 0.78 11 17 0.2 2.7e+03 0.9 0.0 44 73 481 510 440 516 0.77 12 17 0.042 5.7e+02 3.1 0.0 37 71 490 524 483 530 0.83 13 17 0.21 2.8e+03 0.9 0.0 49 73 534 558 524 562 0.80 14 17 0.17 2.3e+03 1.1 0.0 49 71 550 572 537 578 0.58 15 17 0.2 2.7e+03 0.9 0.0 42 70 559 587 552 597 0.63 16 17 0.54 7.3e+03 -0.4 0.0 50 70 599 619 585 638 0.66 17 17 0.64 8.7e+03 -0.7 0.0 39 69 620 650 604 656 0.67
Sequence Information
- Coding Sequence
- ATGGATCACTTTCGACCAACTCGTAACGTTGCAACCGACCGACACCCCACTATATCGACACCCCACTATATCGACACTCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGACACTCCACTATATCGACACCCCACTATATCGACACTCCAGTATATCGACACCCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGACACTCCACTATATCGACACTCCACTATATCGACACCCCACTATATCGACACTCCAGTATATCGACACTCCACTATATCGACACTCCAGTATATCGACACCCCACTATATCGACACTCCTGTATATCGACACCCCACTATCTATATCGACACTCCACTATATCGACACCTCACTATATCGACACTCCAGTATATCGACACCCCACTATATCGACACCCCACTATATCGACACTCCACTATATCGACACTCCATTATATCGACACCCCACTATTTCGACACTCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGACACTCCACTATATCGACACCCCACTATATCGACGCCCCACTATATCGACACCCCACTATATCGACACTCCACTATATCGACACCCCACTATATCGACACTCCACTATATCGACACTCCAGTATATCGACACCCCACTATATCGACCCCCACTATATCGACACCCCACTATATCGACACTCCACTATATCGACACTCCACTATATCGACACTCCAGTATATCGACACTCCACTATATCGACACCCCCACTATATCGACACCCCACTATATCGACACGGCACTATATCGACACTCCACTATATCGACACTCCAGTATATCGACACTACACTATATCGACACTCCAGTATATCGACACTCCACTATATCGACACTCCAGTATATCGACACCCCACTATATCGACAACCCACTATATCGACACTCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGATACTCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGATACTCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGATACTCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGACACTCCACTATATCGACACCCCACTATATCGACACCCTACTATATCGATACCCCACTATATCGATACCCCACTATATCGACACCCCACTATATCGACACCCCACTATCTATATCGATACTCCACTATATCGACACTCCAGTATATCGACACCCCACTATATCGACACCCCACTATATCGACACTCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGACACTCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGATACCCCACTATATCGATACTCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGACACTCCAGTATATCGACACCCCACTATATCGACACCCTACTATATCGACACCCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGACACTCCAGTATATCGACACCCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGACACTCCAGTATATCGACACCCCACTATATCGACACCCTACTATATCGATACCCCACTATATCGATACCCCACTATATCGACACCCCACTATATCGATACTCCACTATATCGACACCCCACTATATCGATACTCCACTATATCGATACCCCACTATATCGACACCCCACTATATCGATACTCCACTATATCGATACTCCACTATATCGACACCCCACTATATCGACACCCCACTATATCGAACTTCACTACATCGACACTCCACTAA
- Protein Sequence
- MDHFRPTRNVATDRHPTISTPHYIDTPLYRHPTISTPHYIDTPLYRHPTISTLQYIDTPLYRHPTISTPHYIDTPLYRHPTISTLHYIDTPLYRHPTISTLQYIDTPLYRHSSISTPHYIDTPVYRHPTIYIDTPLYRHLTISTLQYIDTPLYRHPTISTLHYIDTPLYRHPTISTLHYIDTPLYRHPTISTLHYIDTPLYRRPTISTPHYIDTPLYRHPTISTLHYIDTPVYRHPTISTPTISTPHYIDTPLYRHSTISTLQYIDTPLYRHPHYIDTPLYRHGTISTLHYIDTPVYRHYTISTLQYIDTPLYRHSSISTPHYIDNPLYRHSTISTPHYIDTPLYRYSTISTPHYIDTPLYRYSTISTPHYIDTPLYRYSTISTPHYIDTPLYRHPTISTLHYIDTPLYRHPTISIPHYIDTPLYRHPTISTPHYLYRYSTISTLQYIDTPLYRHPTISTLHYIDTPLYRHPTISTLHYIDTPLYRHPTISIPHYIDTPLYRHPTISTPHYIDTPVYRHPTISTPYYIDTPLYRHPTISTPHYIDTPVYRHPTISTPHYIDTPLYRHPTISTPHYIDTPLYRHPTISTLQYIDTPLYRHPTISIPHYIDTPLYRHPTISILHYIDTPLYRYSTISIPHYIDTPLYRYSTISILHYIDTPLYRHPTISNFTTSTLH
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -