Basic Information

Gene Symbol
znf143_1
Assembly
GCA_963966075.1
Location
OZ014512.1:1081704-1105394[-]

Transcription Factor Domain

TF Family
zf-C2H2
Domain
zf-C2H2 domain
PFAM
PF00096
TF Group
Zinc-Coordinating Group
Description
The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 7 0.0001 0.0078 18.0 0.3 1 23 43 67 43 67 0.93
2 7 4e-05 0.0031 19.3 0.0 1 23 73 97 73 97 0.98
3 7 0.00038 0.029 16.2 0.6 1 23 103 125 103 125 0.96
4 7 0.00094 0.072 15.0 0.5 1 23 131 155 131 155 0.98
5 7 7.1e-06 0.00055 21.7 0.2 1 23 161 185 161 185 0.97
6 7 0.00012 0.0089 17.8 0.5 1 23 191 215 191 215 0.96
7 7 0.00066 0.05 15.5 3.1 1 23 221 244 221 244 0.98

Sequence Information

Coding Sequence
ATGTTGCTTTATGAATATCAAACCATTCAATTGAAGGACGGTCGACATGCAATAATTGAGAAGACGTTATGGTCGTCGCTCTTGCAAAACAACTGCAACGAGGATGGTTCTAAGAAAGTGAAGAAATTCCCGTGTATGTACGACGGATGTGATAAGGTGTACACGACTGCACAACATTTGATTGTCCACGAACGGATTCACACGGGAGATCGCCCATATGTGTGTCCCGTTGCAGGCTGTGATAAGGCGTTTTCAGCTGGCTATACCTTGAAGGCTCACGTGAGAACTCACACCGGCGAGAAGCCGTACTCTTGCGTCGCATGCATTAAGCAGTTCAAAACGTCGGGGGATTTGCAGAAGCACGTCAGGACGCATACAGGCgagaagccatttaaatgtCCGGTGGAAGGCTGCAACCGATCTTTCACAACGTCCAACATTCGAAAGGTTCATATACGATCGCATACTGGGGAGCGCCCTTACGTGTGCCAGATTGAGAACTGCGGTAAAGCGTTTGCGTCTGCCACAAACTACAAAAATCACACCAGGATACATTCCGGGGAGAAGCCCTACGTTTGTCCAGTCGctgaTTGTAACAAAAGATTTACGGAGTATTCATCACTGTACAAGCACAACACGGTACACAAACCTTTCAAACCTTACAAGTGCAGTTACTGTGGACAACTGTGCAAGATAGAGTCGACGTTGAAGGCTCATAAACGGACCATGCATGGTGTTATATTCACCCAGGACGGGTCGGAGATTCTAGTTGATAATGAAGATTATCCGGACGTTGTATTTGAAATTTCTGCGGCAAAGTCAACTTTGCAGTTGAAAGAATGA
Protein Sequence
MLLYEYQTIQLKDGRHAIIEKTLWSSLLQNNCNEDGSKKVKKFPCMYDGCDKVYTTAQHLIVHERIHTGDRPYVCPVAGCDKAFSAGYTLKAHVRTHTGEKPYSCVACIKQFKTSGDLQKHVRTHTGEKPFKCPVEGCNRSFTTSNIRKVHIRSHTGERPYVCQIENCGKAFASATNYKNHTRIHSGEKPYVCPVADCNKRFTEYSSLYKHNTVHKPFKPYKCSYCGQLCKIESTLKAHKRTMHGVIFTQDGSEILVDNEDYPDVVFEISAAKSTLQLKE

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
-
90% Identity
-
80% Identity
-