Basic Information

Transcription Factor Domain

TF Family: HTH
Domain: HTH_psq domain
PFAM: PF05225
TF Group: Helix-turn-helix
Description: This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [1]. In pipsqueak this domain binds to GAGA sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.95 5.6e+02 1.4 0.0 24 34 3 13 3 15 0.85

2 10 0.25 1.5e+02 3.2 0.0 24 34 13 23 9 25 0.85

3 10 0.22 1.3e+02 3.4 0.0 25 36 24 35 23 40 0.88

4 10 2.3 1.4e+03 0.1 0.0 24 34 43 53 43 58 0.84

5 10 1.7 9.8e+02 0.6 0.0 25 37 64 77 61 81 0.84

6 10 0.36 2.1e+02 2.7 0.0 24 34 83 93 83 99 0.87

7 10 6.3 3.7e+03 -1.3 0.0 24 31 93 100 93 101 0.86

8 10 1.6 9.3e+02 0.6 0.0 26 34 105 113 104 124 0.79

9 10 9.1 5.4e+03 -1.8 0.0 24 31 123 130 123 131 0.87

10 10 1.1 6.3e+02 1.2 0.0 25 34 134 143 128 152 0.79

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.95	5.6e+02	1.4	24	34	3	13	3	15	0.85
2	10	0.25	1.5e+02	3.2	24	34	13	23	9	25	0.85
3	10	0.22	1.3e+02	3.4	25	36	24	35	23	40	0.88
4	10	2.3	1.4e+03	0.1	24	34	43	53	43	58	0.84
5	10	1.7	9.8e+02	0.6	25	37	64	77	61	81	0.84
6	10	0.36	2.1e+02	2.7	24	34	83	93	83	99	0.87
7	10	6.3	3.7e+03	-1.3	24	31	93	100	93	101	0.86
8	10	1.6	9.3e+02	0.6	26	34	105	113	104	124	0.79
9	10	9.1	5.4e+03	-1.8	24	31	123	130	123	131	0.87
10	10	1.1	6.3e+02	1.2	25	34	134	143	128	152	0.79

Coding Sequence: ATGCTACGCGTCTACGACGTAGCTCACTCCGCGCTACGCCTCTACGACGTAGCTCACACTGTGTTACGCTTCTACGACGTAGCTCACACTGTGCTACGCCGCTACGACGTAACTCACGCAGTGCTACGCCTCCACGACGTAGCTCACACTGTGCTACGCCTCTACGAAGTAGCTCACATTGCGCCACTACTCTTCGGCGTAACTCACACCGTCCTACGCCTCTACGTCGTAGCTCACACCGTGCTACGCCTCTACGACGTAGCTCACACTGTGCTACGCCTCTACGACGTAGCTCACACTGTGCCATTACTCTTCGGCGTAGCTCACACCGTGCTACGCCTCCACAGCGTAGCTCACACTGTGCTACGCCTCTATGACGTAGCTCACACTGCGCCACTACTCTTTGGCGTAGCCCACACTGTGCTACGACTCTACGACGTAGCTCACACAGAGCTAGGAAATCTTATAGTAAAATGA
Protein Sequence: MLRVYDVAHSALRLYDVAHTVLRFYDVAHTVLRRYDVTHAVLRLHDVAHTVLRLYEVAHIAPLLFGVTHTVLRLYVVAHTVLRLYDVAHTVLRLYDVAHTVPLLFGVAHTVLRLHSVAHTVLRLYDVAHTAPLLFGVAHTVLRLYDVAHTELGNLIVK

Sequence clustering based on sequence similarity using MMseqs2