Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.00047 1.2 9.0 3.0 14 38 204 229 193 233 0.83

2 5 9.6e-05 0.25 11.2 2.1 8 33 227 252 224 258 0.72

3 5 3.6e-05 0.095 12.6 2.5 6 33 253 280 250 285 0.79

4 5 4.8e-05 0.13 12.2 2.3 5 33 280 308 278 314 0.79

5 5 0.00018 0.49 10.3 1.6 13 33 315 336 308 339 0.76

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.00047	1.2	9.0	3.0	14	38	204	229	193	233	0.83
2	5	9.6e-05	0.25	11.2	2.1	8	33	227	252	224	258	0.72
3	5	3.6e-05	0.095	12.6	2.5	6	33	253	280	250	285	0.79
4	5	4.8e-05	0.13	12.2	2.3	5	33	280	308	278	314	0.79
5	5	0.00018	0.49	10.3	1.6	13	33	315	336	308	339	0.76

Coding Sequence: ATGACCGAAATCCGGATCGTTCCCACATTAGTAGATGGGTCGTCACACCTCACCAACCTGTCTGGCCCTGCTGCTACACATAGTAGCAGGGGCAGCACAGGCCATCTTCCTCCACCCCCGGGGTCGCACCTTCAGCAACTCCATGGGTCTGGAGTCCTTACGGATCATACAAAATTACAGTATTTGGGCAACATGCAGGTCCATCCTGCACACAGTGGCAGCGGAGGACATCATCCGCCACCACCGCCCACCCAGGGACCGCCCCAGTCCGCCCATCCGCCACCACCGCAACCGATACCGATCGTGAAGCCGGAGTTTAAGGTGCCACCGATACCGGCCCACCTGATGGATGTGCGCGGTCCGGATGGGTCGCTGGTCAAGATTAACATGCCGGAGCATCACGATCCGAGCAAACCGCCGAACAATGTGGAAATGCTGAAGGTGAACATTGAGGATCTCAGCCAGTTTCTGTCGTACCACGAGGTGTTCGGCAAGCTGCCCTCCGACATGCTGACGGGCCCGTCCGCTAGTTTAGTGCCATCGTCCTCTACCAACACCGCAACGACCAGTGCGCATAGCAATGTAAATCACATCCGTCAgcatacgggcgaatctccgttcaagtgtagctactgtgcgaaaagcttcacccgtaaggaacacctgactaaccacgtTCGCCAgcataccggtgaatcgccttaccgatgtccgtactgcggtaaaacgttcacccgaaaggaacatcttacgaaccatgtcagattgcacacaggcgaaacaccctaccagtgcacatactgcgggaagaagtttacgagaaaagaacaccttaccaatcatgtcagattgcataccggtgaaacgccatttcagtgcacttactgtgagaagaaattcactcgcaaagagcatttaaccaatcacacaaggttgcacaccggcgagactccttttcaatgttcttattgtcagaaaaagttcactaggaaagaacatttaacgaaccacgtcaggtga
Protein Sequence: MTEIRIVPTLVDGSSHLTNLSGPAATHSSRGSTGHLPPPPGSHLQQLHGSGVLTDHTKLQYLGNMQVHPAHSGSGGHHPPPPPTQGPPQSAHPPPPQPIPIVKPEFKVPPIPAHLMDVRGPDGSLVKINMPEHHDPSKPPNNVEMLKVNIEDLSQFLSYHEVFGKLPSDMLTGPSASLVPSSSTNTATTSAHSNVNHIRQHTGESPFKCSYCAKSFTRKEHLTNHVRQHTGESPYRCPYCGKTFTRKEHLTNHVRLHTGETPYQCTYCGKKFTRKEHLTNHVRLHTGETPFQCTYCEKKFTRKEHLTNHTRLHTGETPFQCSYCQKKFTRKEHLTNHVR

Sequence clustering based on sequence similarity using MMseqs2