Akol016441.1
Basic Information
- Insect
- Anopheles koliensis
- Gene Symbol
- CrebA_1
- Assembly
- GCA_000956275.1
- Location
- JXXB01036803.1:5280-5676[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 9.2 9.6e+03 -3.3 0.2 38 47 5 14 4 14 0.63 2 2 5.4e-17 5.6e-14 51.9 14.0 2 60 31 96 30 103 0.84
Sequence Information
- Coding Sequence
- ctgctgctgacggaggaggaaaagcgAACACTGCTGGCGGAAGGCTACCCCATCCCGACCCGGCTGCCGCTGACGAAGGCCGAGGAGAAATCTCTCAAGAAGATTCGGCGGAAGATCAAGAACAAGATCTCCGCACAGGAAAGCCggcggaagaagaaggagtACATGGACCAGCTGGAGCGCCGGGTAGAGATACTCGTGTCGGAGAACGTCGACTACCGCAAGCGCGTCGAAACACTCGAAGACAGCAACAAGAATCTGCAGACGGAGCTCTCGAAACTGCGGCAGCTGATGAACCGGCAGAACGCACGAAAGGCGTGA
- Protein Sequence
- LLLTEEEKRTLLAEGYPIPTRLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYMDQLERRVEILVSENVDYRKRVETLEDSNKNLQTELSKLRQLMNRQNARKA
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01139978;
- 90% Identity
- -
- 80% Identity
- -