Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.00015 0.24 11.1 0.3 15 38 62 82 58 87 0.89

2 5 0.057 91 2.9 0.4 17 28 95 106 85 121 0.71

3 5 0.07 1.1e+02 2.6 0.2 18 28 122 132 113 144 0.81

4 5 4.1e-05 0.065 13.0 0.5 19 41 151 170 139 172 0.88

5 5 0.0011 1.7 8.4 3.4 13 43 173 200 169 201 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.00015	0.24	11.1	0.3	15	38	62	82	58	87	0.89
2	5	0.057	91	2.9	0.4	17	28	95	106	85	121	0.71
3	5	0.07	1.1e+02	2.6	0.2	18	28	122	132	113	144	0.81
4	5	4.1e-05	0.065	13.0	0.5	19	41	151	170	139	172	0.88
5	5	0.0011	1.7	8.4	3.4	13	43	173	200	169	201	0.89

Coding Sequence: AAGAAGGCTTCCAAGGACACTGCCCAAGCTCAGACAGCAGCGGGAACTGTGTCTGCAAACTCCTCCAAACCGGGACAGTGTCCTCCAGCGGCTTCGAAAGCGGACAAGTCCGATCAGCCATCGGCTGACTGTGACTCCGCAGGAGAGTCTGTGAGCGCTCCGAACGGTGGTTCGAATGGGAAGGGCAAGTACAAATGTCCCGAGTGTGGCAAACAGTACGCCACTTCCAGTAATCTTTCGCGCCACAAGCAAACTCATCGGAGTCTTGACTCACAGTCGGCTAAAAAGTGTGTAACCTGCGGTAAGGCGTACGTCTCCATGCCCGCCCTGGCAATGCATCTACTAACACACAAGCTATcgcacagttgtggcgtctgcggcaagctattctctagaccctggctcctgcagggtcatctacggtcacacacgggcgaaaaaccgtacggttgtggtcactgcggtaaggcatttgccgatcggtctaacttgcgagcgcacatgcagacacactccacggacaagaacttcgagtgcaaccggtgtcacaaaacgttcgccCTCAAGTCGTACCTCAACAAGCATCTGGAATCGGCCTGCTACAAAGATGACGATCCGAACGGGAATCCATCCGGGGGTGGTGATAACTCTCCCATCACGATGATCGGTGGACGGAAGATCTTCCACAGCAGTCAGGACATCGATCGGGATGAGTATGCGATGCGAATGGCAAACGGTAGACAGAACTTTCACAACGATGACAGCTGCTCTACCACCACGATCGATGTGGTTACCGCCGATCCGGGCGATGACGACGATGAAGAAGATATCGATATCATAACGACGTAA
Protein Sequence: KKASKDTAQAQTAAGTVSANSSKPGQCPPAASKADKSDQPSADCDSAGESVSAPNGGSNGKGKYKCPECGKQYATSSNLSRHKQTHRSLDSQSAKKCVTCGKAYVSMPALAMHLLTHKLSHSCGVCGKLFSRPWLLQGHLRSHTGEKPYGCGHCGKAFADRSNLRAHMQTHSTDKNFECNRCHKTFALKSYLNKHLESACYKDDDPNGNPSGGGDNSPITMIGGRKIFHSSQDIDRDEYAMRMANGRQNFHNDDSCSTTTIDVVTADPGDDDDEEDIDIITT

Sequence clustering based on sequence similarity using MMseqs2