Basic Information

Insect: Anastatus disparis
Gene Symbol: -
Assembly: GCA_017163975.1
Location: JAFFSR010000268.1:5131328-5136227[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.00057 0.19 14.8 5.1 1 23 91 114 91 114 0.96

2 8 1.9e-06 0.00064 22.6 3.3 2 23 121 143 121 143 0.97

3 8 0.021 7 9.9 0.9 2 12 150 160 150 162 0.91

4 8 4.9e-05 0.017 18.1 0.7 2 23 164 186 163 186 0.97

5 8 4.9e-05 0.017 18.1 0.7 2 23 193 215 192 215 0.97

6 8 3.7e-06 0.0013 21.6 1.4 2 23 222 244 221 244 0.97

7 8 0.00015 0.052 16.6 4.0 2 23 251 273 250 273 0.92

8 8 9.5e-06 0.0032 20.4 0.4 2 23 278 299 277 299 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.00057	0.19	14.8	5.1	1	23	91	114	91	114	0.96
2	8	1.9e-06	0.00064	22.6	3.3	2	23	121	143	121	143	0.97
3	8	0.021	7	9.9	0.9	2	12	150	160	150	162	0.91
4	8	4.9e-05	0.017	18.1	0.7	2	23	164	186	163	186	0.97
5	8	4.9e-05	0.017	18.1	0.7	2	23	193	215	192	215	0.97
6	8	3.7e-06	0.0013	21.6	1.4	2	23	222	244	221	244	0.97
7	8	0.00015	0.052	16.6	4.0	2	23	251	273	250	273	0.92
8	8	9.5e-06	0.0032	20.4	0.4	2	23	278	299	277	299	0.97

Sequence Information

Coding Sequence: ATGGACATTGTCGAAACAAAGCCGACATTTAATACCATATATGACGCTAAAGACTTAGTGAAGCTAGATTTAAATCACTTGTCAACAGCAATCACCAAATATGAATCTGTGAATATTAAAGTTGAAACCGATGGCTTAGATTCAACGCCAATGACAACTGATCTTGAAACCAGTTTGATTTCGATTAAGgatgaaagtttcgggaagcttgaAGATTTGAAAGATGCTTCCTGTGATGAAAATTTAGCTGAATCTCGGAATACCTTTGGCCATATTTGTAAGACatgtaataaaacatttgtttgtCAAGAGAATTTGAAACGTCATGAGCAAACAgttcatttaaaagtaaaaaatgcaAAGTGTTCTCATTGCAACAAATCTTTTACTCAAATAGGTAATTTGAAACGTCATGAGCAAACAGTTCATTTAAAAGTCAAAAATGCGAAGTGTTCTCATTGCAACAAATCTTTTACTCAAATAGACTGGAAGTGTGATCTCTGTGACAAATATTTTGCCGAAAAGAATAGTTTAAAAGTTCACAAGAAAACAGTTCATTTGAAGATTCGAGACTGGAAGTGTGATCTCTGTGACAAATATTTTGCCGAAAAGAATAGTTTAAAAGTTCACAAGAAAACAGTTCATTTGAAGATTCGAGACTGGAAGTGTAATCTTTGCGACAAATATTTTACCGTGAAGAGTAGTTTAAAAGTTCACAAGAAAACAGTTCATTTGAAGATTCGAGACTGTAAGTGTGATCTCTGCGACAAACATTTCACCCAAATGGGTAGTTTAAATCGTCACAAACAAGCAGTTCATTTGAAAAACTGGCAATGTAATATTTGTGAGaaaagttttgcaaaaaaagtGAATTTAGATTCTCACAGTAGAGTTCATTCAATTGATTTAAGTTAG
Protein Sequence: MDIVETKPTFNTIYDAKDLVKLDLNHLSTAITKYESVNIKVETDGLDSTPMTTDLETSLISIKDESFGKLEDLKDASCDENLAESRNTFGHICKTCNKTFVCQENLKRHEQTVHLKVKNAKCSHCNKSFTQIGNLKRHEQTVHLKVKNAKCSHCNKSFTQIDWKCDLCDKYFAEKNSLKVHKKTVHLKIRDWKCDLCDKYFAEKNSLKVHKKTVHLKIRDWKCNLCDKYFTVKSSLKVHKKTVHLKIRDCKCDLCDKHFTQMGSLNRHKQAVHLKNWQCNICEKSFAKKVNLDSHSRVHSIDLS*

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -