Basic Information

Transcription Factor Domain

TF Family: HSF
Domain: HSF_DNA-bind domain
PFAM: PF00447
TF Group: Helix-turn-helix
Description: Heat shock factor (HSF) is a transcriptional activator of heat shock genes [1, 4]: it binds specifically to heat shock promoter elements, which are palindromic sequences rich with repetitive purine and pyrimidine motifs [1]. Under normal conditions, HSF is a homo-trimeric cytoplasmic protein, but heat shock activation results in relocalisation to the nucleus [2]. Each HSF monomer contains one C-terminal and three N-terminal leucine zipper repeats [3]. Point mutations in these regions result in disruption of cellular localisation, rendering the protein constitutively nuclear [2]. Two sequences flanking the N-terminal zippers fit the consensus of a bi- partite nuclear localisation signal (NLS). Interaction between the N- and C-terminal zippers may result in a structure that masks the NLS sequences: following activation of HSF, these may then be unmasked, resulting in relocalisation of the protein to the nucleus [3]. The DNA-binding component of HSF lies to the N terminus of the first NLS region, and is referred to as the HSF domain.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 9.4e-28 3.6e-23 84.6 0.2 1 100 40 147 40 147 0.93

2 3 0.79 3e+04 -1.8 0.1 78 78 186 186 152 238 0.59

3 3 0.4 1.5e+04 -0.9 0.2 37 69 227 258 196 281 0.62

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	9.4e-28	3.6e-23	84.6	0.2	1	100	40	147	40	147	0.93
2	3	0.79	3e+04	-1.8	0.1	78	78	186	186	152	238	0.59
3	3	0.4	1.5e+04	-0.9	0.2	37	69	227	258	196	281	0.62

Coding Sequence: ATGTCCgatgttaataaaaatcaattttcaccAACTAATAATTCaacaagttttaataatttgagCACAACAATTAACGCAGCAGCAACGGACGATTGTGTTATACCATCATTACGTTTTCCGCAAAAACTTTGGCGCATTGTAAACGAATGTCAAAATGGAGCCATAAAATGGGGTAACGATGGACTTAGtattatgattaattataaaacttttcaagATCAATATCTCGGTAGTGATGCTTCTGTATTCAAGACAAGTAATATAGCTAGCTTTATACGTCAATTAAATCTTTATGGTTTTCGTAAAGTAACTTCGCATAATCGTGAGCTTTATGCTGCTGGTATTAACATTGTGCATCATCATCAAGATATGCACGAATTTGTACACGAATATTTTAGAGCTGGTAGACTTGATTTATTATCGAGAGTTTGTAGAAAAACTGCTCTTAAGAAGAATATCCAACAAACCAATAAGCCAATCGTCAACAAACTCAATATTTCGTCGTTCtccccctcctcctcctcctcttcgTCCGAGACCAAAGATAATCAAATGACCGGCATGACCAGACTACAAATGTGTcaaATTGCATTAACAAAAGCTTTAGAGCAAGCAAccaaagaatataaaaaagataaaatttccAATTTACAGCTTTTAAAAGAAAGTAGCCCTCAAGATACATTGAAGccaaaatttaaaaCGGAAACATTGGAATccaatattcaaattatttttcaagatttcTCACAAGTACAGACTGAACAAAATATTCCAGTAATAGATGCTTCGaatgtagaaaattttattgattatcaAGATAAAATACAATGGGAAGAAGTTTTTACTTTACCAGTGGATAATTCAGTTGCACCAccattttga
Protein Sequence: MSDVNKNQFSPTNNSTSFNNLSTTINAAATDDCVIPSLRFPQKLWRIVNECQNGAIKWGNDGLSIMINYKTFQDQYLGSDASVFKTSNIASFIRQLNLYGFRKVTSHNRELYAAGINIVHHHQDMHEFVHEYFRAGRLDLLSRVCRKTALKKNIQQTNKPIVNKLNISSFSPSSSSSSSETKDNQMTGMTRLQMCQIALTKALEQATKEYKKDKISNLQLLKESSPQDTLKPKFKTETLESNIQIIFQDFSQVQTEQNIPVIDASNVENFIDYQDKIQWEEVFTLPVDNSVAPPF*

Sequence clustering based on sequence similarity using MMseqs2