Amac007838.1
Basic Information
- Insect
- Anaspis maculata
- Gene Symbol
- -
- Assembly
- GCA_949128115.1
- Location
- OX421962.1:2431779-2432612[-]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 9 1.3 71 5.4 0.1 15 23 3 11 2 11 0.92 2 9 0.00049 0.027 16.1 4.7 1 23 20 42 20 42 0.99 3 9 0.017 0.95 11.3 3.2 1 23 51 73 51 73 0.98 4 9 0.00014 0.0079 17.8 2.8 1 23 82 104 82 104 0.98 5 9 0.0029 0.16 13.7 1.0 4 23 114 135 113 135 0.90 6 9 0.00024 0.013 17.1 2.3 1 23 144 166 144 166 0.98 7 9 2.2e-05 0.0012 20.4 1.3 1 23 175 198 175 198 0.98 8 9 0.00013 0.007 18.0 1.2 1 23 207 229 207 229 0.98 9 9 1.1 58 5.6 0.5 1 17 238 254 238 255 0.92
Sequence Information
- Coding Sequence
- ATGGGAGATTTGAAAGCGCACATGAGGAAACATGCCGCCGCCGAGGACGTCGTTTGGTTCCGTTGTGCGAAGTGTTCGTTCAGAACCAAGTACAATAACAATTTGAAGACGCACATGAGGAAACACACCGCCGCCGAAGACACCATTTGGTTTGAATGTGGACAGTGTTCGTTCAAAACCAACCTGaaacacagcttgaaagtgCACATGTTGAGGCATTCAGCCGCTGAAGACACCGACTGGTtccaatgtgcaaagtgttcgtaCAAATCCAACCGAAAAGGGAATTTGAGAACGCACATGTCGAAACATGCCGTCACTGAAAAGGTCGTTTGGTGTCAGCAACCGGGGTGTTCCTACAGAACCAACCAGAAAGAGctcttgaaaaggcacatgttgaaacacgccGCTGCTGAAGACGCCGTTTGGTTTCAGTGTGCAACGTGCCCGTATAGAACCAGGTACAGCAGCAATTACAagatgcacatgttgaaacatgccgccGTCGAAGACATCGTTCGGTTCCAGTGTGCGGAGTGTCCGTATGAAACTACTCGGAAAAGAAACTTGAAACTACACATGTCAACTAAACACGCCGCCggtgaagacatcgtttggtttgaatgtacggagtgttcgtataaaaCCAACCGGAAAGGGCCTTTGAAGACGCACATGTTGACGCACGCTGCCgccgaagacatcgattggttccaatgtgcaaagtgttcgtataaaacgAACCGGAAAGGCGGCTTGAAAGGGCTCCGTGAAGTTGGCGGACGACTTGAAGCACTAATGTTGAAACTTCGTATATGCTTAGTGCTTCATTAG
- Protein Sequence
- MGDLKAHMRKHAAAEDVVWFRCAKCSFRTKYNNNLKTHMRKHTAAEDTIWFECGQCSFKTNLKHSLKVHMLRHSAAEDTDWFQCAKCSYKSNRKGNLRTHMSKHAVTEKVVWCQQPGCSYRTNQKELLKRHMLKHAAAEDAVWFQCATCPYRTRYSSNYKMHMLKHAAVEDIVRFQCAECPYETTRKRNLKLHMSTKHAAGEDIVWFECTECSYKTNRKGPLKTHMLTHAAAEDIDWFQCAKCSYKTNRKGGLKGLREVGGRLEALMLKLRICLVLH
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -