Ainn012461.1
Basic Information
- Insect
- Anarsia innoxiella
- Gene Symbol
- cdc5l
- Assembly
- GCA_947563765.1
- Location
- OX387394.1:11204312-11205595[-]
Transcription Factor Domain
- TF Family
- MYB
- Domain
- Myb_DNA-binding domain
- PFAM
- PF00249
- TF Group
- Helix-turn-helix
- Description
- This family contains the DNA binding domains from Myb proteins, as well as the SANT domain family [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 4.7e-18 5e-15 55.7 1.8 2 46 9 54 8 54 0.97 2 2 5.7e-13 6e-10 39.4 0.1 1 45 60 103 60 104 0.93
Sequence Information
- Coding Sequence
- atgccgcggattatgataaagggcggcgtttggcgcaacaccgaggatgagatcctcaaggcggcggtgatgaaatatggcaaaaaccagtggtctcgtattgcgtctttgctccaccgcaaatcggctaagcaatgcaaggcgagatggtacgagtggttggacccgagtatcaagaagacggagtggtcccgggaggaggacgagaagctactgcacttggccaagctgatgccaacacagtggaggaccatcgcgcctattattgggagaactgcagcacaatgtttagaaagatacgagtatctTTTGGATCAAGCCCAAAAGAAAGAAGAGGGTGATGATATGGGCGATGACCCTCGGAAATTGAAGCCAGGAGAGATAGATCCAAATCCTGAAACCAAGCCTGCTAGACCAGATCCTAAGGATATGGATGAAGATGGGCTTGGAACCGGTTTTAAAATAACGGTTAATATCGTTCCTAAAACCGATACTTTCAATGGTACTTGA
- Protein Sequence
- MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEDEKLLHLAKLMPTQWRTIAPIIGRTAAQCLERYEYLLDQAQKKEEGDDMGDDPRKLKPGEIDPNPETKPARPDPKDMDEDGLGTGFKITVNIVPKTDTFNGT
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00836512;
- 90% Identity
- iTF_00780969;
- 80% Identity
- iTF_00874406; iTF_00876114;