Basic Information

Transcription Factor Domain

TF Family: TEA
Domain: TEA domain
PFAM: PF01285
TF Group: Helix-turn-helix
Description: The TEA domain is a DNA-binding region of about 66 to 68 amino acids that has been named after the two proteins that originally defined the domain: TEF-1 and AbaA. The TEA domain is located toward the N terminus of eukaryotic transcription factors of the TEA/ATTS family. It shows a three-helix bundle with a homeodomain fold [3, 1]. Two α-helices are nearly anti-parallel and pack on either side of the third one, which is the DNA-recognition helix of the TEA domain. Phosphorylation of one or both of the two conserved serines found on the DNA-binding surface could interfere with DNA-binding activity, by introducing electrostatic repulsion and/or steric hindrance, and help regulate the transcription factor activity of the proteins [2, 1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.00074 15 7.1 0.1 27 55 26 52 6 54 0.81

2 5 0.00097 19 6.7 0.1 27 55 63 89 53 91 0.82

3 5 0.00091 18 6.8 0.1 27 55 100 126 90 130 0.82

4 5 0.00094 19 6.8 0.1 27 55 137 163 126 165 0.81

5 5 0.00092 18 6.8 0.1 27 55 174 200 164 204 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.00074	15	7.1	0.1	27	55	26	52	6	54	0.81
2	5	0.00097	19	6.7	0.1	27	55	63	89	53	91	0.82
3	5	0.00091	18	6.8	0.1	27	55	100	126	90	130	0.82
4	5	0.00094	19	6.8	0.1	27	55	137	163	126	165	0.81
5	5	0.00092	18	6.8	0.1	27	55	174	200	164	204	0.82

Coding Sequence: ATGAAGGCCTCGCTCTACGCAGACACAGGTGAGGAGAGAGAGAGGGAGAGGGAGAGCCCCACGAGCGAGCTGGCGCGCCTGGAGCACCGGCAGAGCCACCGCCACCAGCTCATGAAGGCCTCGCTCTACGCAGACACAGGTGAGGAGAGAGAGAGGGAGAGGGAGAGCCCCACGAGCGAGCTGGCGCGCCTGGAGCACCGGCAGAGCCACCGCCACCAGCTCATGAAGGCCTCGCTCTACGCAGACACAGGTGAGGAGAGAGAGAGGGAGAGGGAGAGCCCCACGAGCGAGCTGGCGCGCCTGGAGCACCGGCAGAGCCACCGCCACCAGCTCATGAAGGCCTCGCTCTACGCAGACACAGGTGAGGAGAGAGAGAGGGAGAGGGAGAGCCCCACGAGCGAGCTGGCGCGCCTGGAGCACCGGCAGAGCCACCGCCACCAGCTCATGAAGGCCTCGCTCTACGCAGACACAGGTGAGGAGAGAGAGAGGGAGAGGGAGAGCCCCACGAGCGAGCTGGCGCGCCTGGAGCACCGGCAGAGCCACCGCCACCAGCTCATGAAGGCCTCGCTCTACGCAGACACAGGTGAGGAGAGAGAGAGGGAGAGGGAGAGCCCCACGAGCGAGCTGGCGCGCCTGGAGCACCGGCAGAGCCACCGCCACCAGCTCATGAAGGCCTCGCTCTACGCAGACAGGTGA
Protein Sequence: MKASLYADTGEERERERESPTSELARLEHRQSHRHQLMKASLYADTGEERERERESPTSELARLEHRQSHRHQLMKASLYADTGEERERERESPTSELARLEHRQSHRHQLMKASLYADTGEERERERESPTSELARLEHRQSHRHQLMKASLYADTGEERERERESPTSELARLEHRQSHRHQLMKASLYADTGEERERERESPTSELARLEHRQSHRHQLMKASLYADR

Sequence clustering based on sequence similarity using MMseqs2