Basic Information

Insect: Alloplasta piceator
Gene Symbol: -
Assembly: GCA_946863875.1
Location: OX333074.1:3784325-3785269[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 6.8e-06 0.0009 20.3 0.6 1 23 15 38 15 38 0.96

2 9 4.4e-05 0.0058 17.7 3.4 1 23 44 66 44 66 0.98

3 9 1.1e-05 0.0015 19.6 0.7 1 23 72 94 72 94 0.97

4 9 0.00016 0.021 15.9 0.5 1 23 100 122 100 122 0.97

5 9 6.8e-06 0.00089 20.3 2.8 3 23 135 155 133 155 0.96

6 9 3.4e-07 4.4e-05 24.4 1.0 1 23 164 186 164 186 0.99

7 9 1.3e-05 0.0017 19.4 1.8 1 23 192 214 192 214 0.98

8 9 1e-05 0.0014 19.7 4.8 1 23 220 242 220 242 0.98

9 9 1.8e-06 0.00024 22.1 1.1 1 23 248 270 248 270 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	6.8e-06	0.0009	20.3	0.6	1	23	15	38	15	38	0.96
2	9	4.4e-05	0.0058	17.7	3.4	1	23	44	66	44	66	0.98
3	9	1.1e-05	0.0015	19.6	0.7	1	23	72	94	72	94	0.97
4	9	0.00016	0.021	15.9	0.5	1	23	100	122	100	122	0.97
5	9	6.8e-06	0.00089	20.3	2.8	3	23	135	155	133	155	0.96
6	9	3.4e-07	4.4e-05	24.4	1.0	1	23	164	186	164	186	0.99
7	9	1.3e-05	0.0017	19.4	1.8	1	23	192	214	192	214	0.98
8	9	1e-05	0.0014	19.7	4.8	1	23	220	242	220	242	0.98
9	9	1.8e-06	0.00024	22.1	1.1	1	23	248	270	248	270	0.98

Sequence Information

Coding Sequence: ATGAAGGTAATATGCGATGGAACGGTCGATCCGAAGGTAGTAtacgtgtgcgatcaatgcggtctgagcttcgacgattccattgatctgcggaagcatcatcagcaggtacatcctgtggagaagagtcacgtttgcgagacatgcggttacacgagtgcgcatcgtcagaatctcataagtcatcagcgtcgtcacaatctggagtacaagtacaactgtgagctatgcggtaccggtttttattcacggagcaattatcaggagcaccaattgttgcacactagagagaagccatttcagtgtgtgatatgcaacgcaacgtttcgctatcgtcagggtttgcgtttgcacgcgaagctgcatcagcccgattacgttccaccgcagaagaagcatctttgcgaattgtgcaacaagcgtttctccaggaaacaagtattgctggtccacatgaggacacacggaacgggaggaccccagaacgagtacgtttgtcacatttgcggcaaagccgtgtccagtaaaacgtacttgaccgttcacgtgcgcaaacacaccggcgagaaaccgcatgtctgcgatttgtgccagaagggcttcatatcgcagaattatctgagtgtccacagaaggactcacaccggggagagaccccatcagtgcacgcactgcgagaaacgattcactcaacgaacgaccttggtcgttcatctgcgtggacacaccggcgatcgaccgtatccttgcgccttctgtcaaaagtcattcgcctcgaagactatgctgaacagccacttgaagacTCACGACAAGCAAAACGCGAGGGCACAACAGGCCCAGCATCAGCAGATCGAGATGCAACAGCGACAGCAGGATATCCAGCAGAATGAAGAGGGGTCGTCGCAGTCCCTCGAAAATGTTACGGTCTTGTTATCGGGTTGA
Protein Sequence: MKVICDGTVDPKVVYVCDQCGLSFDDSIDLRKHHQQVHPVEKSHVCETCGYTSAHRQNLISHQRRHNLEYKYNCELCGTGFYSRSNYQEHQLLHTREKPFQCVICNATFRYRQGLRLHAKLHQPDYVPPQKKHLCELCNKRFSRKQVLLVHMRTHGTGGPQNEYVCHICGKAVSSKTYLTVHVRKHTGEKPHVCDLCQKGFISQNYLSVHRRTHTGERPHQCTHCEKRFTQRTTLVVHLRGHTGDRPYPCAFCQKSFASKTMLNSHLKTHDKQNARAQQAQHQQIEMQQRQQDIQQNEEGSSQSLENVTVLLSG

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00263745;
90% Identity: -
80% Identity: -