Basic Information

Insect: Aleochara bilineata
Gene Symbol: topi
Assembly: GCA_003054995.1
Location: NBZA01001932.1:66752-67687[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.00013 0.015 15.6 2.4 1 23 18 41 18 41 0.95

2 10 8.1e-06 0.00095 19.4 0.4 1 23 45 67 45 67 0.98

3 10 0.53 62 4.3 0.2 1 21 73 93 73 94 0.90

4 10 0.00064 0.074 13.5 0.8 1 23 102 124 102 124 0.96

5 10 1.2e-06 0.00014 22.0 0.3 1 23 130 153 130 153 0.97

6 10 0.00065 0.075 13.5 4.7 1 23 163 185 163 185 0.97

7 10 0.00038 0.045 14.2 0.5 2 23 191 212 191 212 0.97

8 10 3.6e-05 0.0042 17.4 0.5 1 23 218 240 218 240 0.98

9 10 1.8e-07 2.1e-05 24.7 2.9 1 23 246 268 246 268 0.98

10 10 0.00047 0.055 13.9 0.9 1 22 274 295 274 295 0.93

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.00013	0.015	15.6	2.4	1	23	18	41	18	41	0.95
2	10	8.1e-06	0.00095	19.4	0.4	1	23	45	67	45	67	0.98
3	10	0.53	62	4.3	0.2	1	21	73	93	73	94	0.90
4	10	0.00064	0.074	13.5	0.8	1	23	102	124	102	124	0.96
5	10	1.2e-06	0.00014	22.0	0.3	1	23	130	153	130	153	0.97
6	10	0.00065	0.075	13.5	4.7	1	23	163	185	163	185	0.97
7	10	0.00038	0.045	14.2	0.5	2	23	191	212	191	212	0.97
8	10	3.6e-05	0.0042	17.4	0.5	1	23	218	240	218	240	0.98
9	10	1.8e-07	2.1e-05	24.7	2.9	1	23	246	268	246	268	0.98
10	10	0.00047	0.055	13.9	0.9	1	22	274	295	274	295	0.93

Sequence Information

Coding Sequence: ATGGCTTCCAAAGTGGCCAAGCAGCAGACCAAGAAGACAAAGAGCAAGATGCATTCGTGCGATATGTGCGCGAAACGCTTCAAGACTACCGCGATGTTGAAGCAGCATATTCTCAATTTCCACTCGAACATCTACAACTGTAACGAATGCAGCGAGTCATTCAATACACCGTTGGAGTACACCCTTCATATGAAGATTCACACGGATGATAAGAACTACCAATGCGTGCTGTGCGATTTTGAAACGCTTAATATCGAAGAACTAAAGCAGCACCTGAAGAAATGCTCAGACCGCGCGCCGCGATTTACTTGCACTATTTGTAAAAAAGGCTTCAACGTACGCACTTGGTACTTGGAGCACGCCAATTATCACACCGGGGATAAGCCGTTTGTTTGTGAGATCTGCGGCAAGGCGTTTATCTACTCACGATACCTCTCCGCGCATCGTTCAACGCAACATAAGTTCAACGGCGAGGAAAAGAAACTGCATCACTGCACCCTCTGTGAGAAGGTTTACCAGCATCGTAACAGTCTCGCTATCCACATGAACATCCACACCGGCAACGGTGCCGTCTGCGATATTTGCGGCAAGTTGCTCTCCAGCAAAGAGAAGCTTAAGTTCCACATGCGCATCCACAGCGGCTACAAGCCTTTCAAGTGCACGTACTGCGAGAAAGCCTTCATCAAGAAGACCATCTTGGTGGAgcatattcgcattcacacTGGGGAGAAACCCTACCGGTGCGAGTACTGCGGCAAGTGTTTCTCGCAGCGGAGTAGCATGGTCACGCATGTGCGTGGGCATACCGGCGAACGCCCTCATGTCTGCCATTTCTGCGGCAAAGGGTTTGTGGCCAAGGCCATGCTCAACTTGCATTTTAAGACTTGTAAAGGCTACATTTACCCGCCGCCGTCGAATAATGtattgactaattaa
Protein Sequence: MASKVAKQQTKKTKSKMHSCDMCAKRFKTTAMLKQHILNFHSNIYNCNECSESFNTPLEYTLHMKIHTDDKNYQCVLCDFETLNIEELKQHLKKCSDRAPRFTCTICKKGFNVRTWYLEHANYHTGDKPFVCEICGKAFIYSRYLSAHRSTQHKFNGEEKKLHHCTLCEKVYQHRNSLAIHMNIHTGNGAVCDICGKLLSSKEKLKFHMRIHSGYKPFKCTYCEKAFIKKTILVEHIRIHTGEKPYRCEYCGKCFSQRSSMVTHVRGHTGERPHVCHFCGKGFVAKAMLNLHFKTCKGYIYPPPSNNVLTN

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00902471;
90% Identity: iTF_00904291;
80% Identity: -