Aalt021983.1
Basic Information
- Insect
- Aleiodes alternator
- Gene Symbol
- -
- Assembly
- GCA_963921955.1
- Location
- OY998112.1:4440898-4442597[+]
Transcription Factor Domain
- TF Family
- zf-MIZ
- Domain
- zf-MIZ domain
- PFAM
- PF02891
- TF Group
- Zinc-Coordinating Group
- Description
- This domain has SUMO (small ubiquitin-like modifier) ligase activity and is involved in DNA repair and chromosome organisation [1][2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.1e-09 1.5e-05 25.3 0.3 1 46 63 106 63 112 0.89
Sequence Information
- Coding Sequence
- atggacactccaattgaacggttcgagataAGATACGAGCAAGAAGTTGGTAAAATTGAAGTCGATGTCGCGGAGAATAagcaattgagaaatttcaatcttcAGGTCAAACAGTTGATTTcatCCTGTGGTGGAGAAGGGGGAAGTCAAGCCGATGATGACGAAGAAATGACGGTGACGGCAAATGTCAATGTTATTTGTCCAATATCAAAAACCAGAATGAAAGAAccaatgaagaatgaaatttgtgGACACGTTTATGACAAAGAGAGCGTTCTTGCTATGATTAAAGTTAATTTAAGATCCAGATGTCCAGTGGTTGGATGCAGTAACAAAGAATTCCTGAGCATGGCGCAAATGCATACTGATATTGTGACCAAAGtttatttggagaaaaatccataa
- Protein Sequence
- MDTPIERFEIRYEQEVGKIEVDVAENKQLRNFNLQVKQLISSCGGEGGSQADDDEEMTVTANVNVICPISKTRMKEPMKNEICGHVYDKESVLAMIKVNLRSRCPVVGCSNKEFLSMAQMHTDIVTKVYLEKNP
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -