Aalt002702.1
Basic Information
- Insect
- Aleiodes alternator
- Gene Symbol
- -
- Assembly
- GCA_963921955.1
- Location
- OY998098.1:3183527-3183961[-]
Transcription Factor Domain
- TF Family
- HTH
- Domain
- HTH_psq domain
- PFAM
- PF05225
- TF Group
- Helix-turn-helix
- Description
- This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [1]. In pipsqueak this domain binds to GAGA sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 2.6e-07 0.00025 21.3 0.0 5 38 19 52 16 56 0.92 2 2 8 7.8e+03 -2.7 0.0 31 42 98 110 98 113 0.73
Sequence Information
- Coding Sequence
- atggtgagaaaatatgtaaaaaaaacagacagaCAGTCTTGGGATGATATTTCCATGGCTGGAGCCATTGCATCTGTCGTGGAAGATCATTCAGCATTAAAGAGTGCagcgaaaaatttcaatgttcCAAGAACTACACTTAGACGAAGAGTtgaactatttgaaaaattcaaagacaTGGAAATTGCAATCACTAAAGGTATGGGTAATTTCCAAACAGTATTCACTCATTCACAAGAAGCTGAATTAACTGCTTATTTGAAAGAGCAAGAGAATCGACTGTATGACTTAACGAGTCTACAACTTCGAGTACTTGCTCGGCAGATTGCTGAGAAGAATGGTATTATTCATTCCTAG
- Protein Sequence
- MVRKYVKKTDRQSWDDISMAGAIASVVEDHSALKSAAKNFNVPRTTLRRRVELFEKFKDMEIAITKGMGNFQTVFTHSQEAELTAYLKEQENRLYDLTSLQLRVLARQIAEKNGIIHS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -