Basic Information

Insect: Agriphila straminella
Gene Symbol: -
Assembly: GCA_950108535.1
Location: OX467319.1:13741451-13750280[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.0058 0.53 11.8 0.2 2 23 21 43 20 43 0.90

2 10 0.11 10 7.8 1.2 1 23 47 69 47 69 0.97

3 10 0.013 1.2 10.7 2.6 2 23 75 97 75 97 0.97

4 10 9.6e-05 0.0088 17.4 0.0 2 23 103 125 103 125 0.95

5 10 0.0009 0.082 14.4 0.1 1 22 135 156 135 160 0.94

6 10 3.3 3e+02 3.1 4.2 2 23 198 220 197 220 0.91

7 10 0.00022 0.02 16.3 0.4 2 23 234 255 233 255 0.97

8 10 6.4e-06 0.00059 21.1 0.6 1 23 260 282 260 282 0.98

9 10 1.6e-05 0.0015 19.9 0.9 1 23 288 310 288 310 0.97

10 10 0.00013 0.012 17.0 3.2 1 23 316 339 316 339 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.0058	0.53	11.8	0.2	2	23	21	43	20	43	0.90
2	10	0.11	10	7.8	1.2	1	23	47	69	47	69	0.97
3	10	0.013	1.2	10.7	2.6	2	23	75	97	75	97	0.97
4	10	9.6e-05	0.0088	17.4	0.0	2	23	103	125	103	125	0.95
5	10	0.0009	0.082	14.4	0.1	1	22	135	156	135	160	0.94
6	10	3.3	3e+02	3.1	4.2	2	23	198	220	197	220	0.91
7	10	0.00022	0.02	16.3	0.4	2	23	234	255	233	255	0.97
8	10	6.4e-06	0.00059	21.1	0.6	1	23	260	282	260	282	0.98
9	10	1.6e-05	0.0015	19.9	0.9	1	23	288	310	288	310	0.97
10	10	0.00013	0.012	17.0	3.2	1	23	316	339	316	339	0.98

Sequence Information

Coding Sequence: ATGAACTCGCGGCGATCACcgtATCGAAATATTAATGTTCAGAATCTACGAGGTGTGTGGGAGTGTCCTGTCTGTCTGTTGCGGTTCAGAACTAGAGAGTATCTGTGGATACACTCGTACAGCTACCACGAACATATGTATCGCTGCAAATCCTGCCCGTACTCTGCCAATAATCGcGGTCACGCTGTGCAGCACTCGCGCGAGCATGCAGGCTACCAGGCAAGTTGCCCGCTGTGCCCGTTCAAGGGCAAGCACCCGTCCAGTGTGACTCACCACGTGCGCACCCGGCACAAGGAGGAAGCGGAAACATGCGCCAAATGCGGCCTTGTGTTTGTTAGCACCGCGGGACTTAAAGTTCATATGAGGGCCGTGCACGACGAGACATCCAATGAGacggatttatacccttgtgagaAATGTGGTATAAACTTCAAATCGGAAGACGATAAACTTATACACTTGCGCACATCTCCGGCGCACAGCAACGACAATGACGTTGAAGTATACTCTTCTGCTTTAAAGCcgacaaagaaaaagaaagtCGGCGCACGATACAGGCACAGTCAAGTTGATCGAGATGGCTATCCCAAAAAGTGTGATCATTGCGATCTGGTGTTGACCAGTCGCGGGGGACACTTTCGGCACACGCAGAACAAACACCGCGACATAAAGCACGCGTACCGACCGCTCGTCAGGGTCGTCTGCGACGTCTGCGGGAAGGGGCTGACGAACCACACTATGCTCAAGATACACTTACTGAAGCACGGGCCTCCGACGTACGCATGCGCCGATTGCCCGCGCAAGTTCCATGACAAGTACGCGCTGGCGCGGCACGTGCGCATGCACCGGCCCGGCCTGCCCTACCGCTGCGACCAGTGCCCGAGTGCCTTCAAGCACCCCGGAAACCTGATACGACATAAGAAGGGACATTCCGACCTCACGCCGTACGAGTGTAAAATTTGCTTCAAAAAGTTCAAACAACACCCTTACTTAAGCCTACACGTGAAAACAGTTCACTATGGCATGCCGCACCCGCCACGGAAGAAGCGCACTCGCAACAAGAAAAGAGAggaataa
Protein Sequence: MNSRRSPYRNINVQNLRGVWECPVCLLRFRTREYLWIHSYSYHEHMYRCKSCPYSANNRGHAVQHSREHAGYQASCPLCPFKGKHPSSVTHHVRTRHKEEAETCAKCGLVFVSTAGLKVHMRAVHDETSNETDLYPCEKCGINFKSEDDKLIHLRTSPAHSNDNDVEVYSSALKPTKKKKVGARYRHSQVDRDGYPKKCDHCDLVLTSRGGHFRHTQNKHRDIKHAYRPLVRVVCDVCGKGLTNHTMLKIHLLKHGPPTYACADCPRKFHDKYALARHVRMHRPGLPYRCDQCPSAFKHPGNLIRHKKGHSDLTPYECKICFKKFKQHPYLSLHVKTVHYGMPHPPRKKRTRNKKREE

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -