Amal004986.1
Basic Information
- Insect
- Agrilus mali
- Gene Symbol
- CEBPG
- Assembly
- GCA_029378335.1
- Location
- CM055655.1:16797693-16798097[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.8e-13 4e-10 40.6 7.6 2 65 20 83 19 83 0.95
Sequence Information
- Coding Sequence
- ATGGCCCCACAacgtaataaaagtaaaaaagaagATGTGATAGATTCAGGGGACGAATCTGAAGAATACAGGAAAAAACGGGATCGTAACAATTTGGCAGTGAAAAGAAGTCGAATTAAGtcaaaaataaagacacaagAAACCATGAAGAAAGTAAACCAGTTGCGcaatgaaaattcaattttggaagaaaaagtgaaaaatctTACAAAAGAACTGgggtttttaaaagaattgtttttAGCTCATGCTAGTAACTCTAGCGATAAAGCTAAATTTGAGAACATTGATTTACAAAAACTCTTAGCTGATGATAGTACATCTTCTGAAAatgaatcaaaaaaataa
- Protein Sequence
- MAPQRNKSKKEDVIDSGDESEEYRKKRDRNNLAVKRSRIKSKIKTQETMKKVNQLRNENSILEEKVKNLTKELGFLKELFLAHASNSSDKAKFENIDLQKLLADDSTSSENESKK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00030751;
- 90% Identity
- iTF_00030751;
- 80% Identity
- -