Aful046331.1
Basic Information
- Insect
- Agonum fuliginosum
- Gene Symbol
- -
- Assembly
- GCA_947534325.1
- Location
- OX384033.1:36525097-36529520[-]
Transcription Factor Domain
- TF Family
- GCM
- Domain
- GCM domain
- PFAM
- PF03615
- TF Group
- Beta-Scaffold Factors
- Description
- GCM transcription factors are a family of proteins which contain a GCM motif. The GCM motif is a domain that has been identified in proteins belonging to a family of transcriptional regulators involved in fundamental developmental processes which comprise Drosophila melanogaster GCM and its mammalian homologues [PMID: 8962155, PMID: 9114061, PMID: 9580683, PMID: 10671510]. IN GCM transcription factors the N-terminal moiety contains a DNA-binding domain of 150 residues. Sequence conservation is highest in this GCM domain. In contrast, the C-terminal moiety contains one or two transactivating regions and is only poorly conserved.The GCM motif has been shown to be a DNA binding domain that recognises preferentially the nonpalindromic octamer 5'-ATGCGGGT-3' [PMID: 8962155, PMID: 9114061, PMID: 9580683]. The GCM motif contains many conserved basic amino acid residues, seven cysteine residues, and four histidine residues [PMID: 8962155]. The conserved cysteines are involved in shaping the overall conformation of the domain, in the process of DNA binding and in the redox regulation of DNA binding [PMID: 9580683]. The GCM domain as a new class of Zn-containing DNA-binding domain with no similarity to any other DNA-binding domain [PMID: 12682016]. The GCM domain consists of a large and a small domain tethered together by one of the two Zn ions present in the structure. The large and the small domains comprise five- and three-stranded beta-sheets, respectively, with three small helical segments packed against the same side of the two beta-sheets. The GCM domain exercises a novel mode of sequence-specific DNA recognition, where the five-stranded beta-pleated sheet inserts into the major groove of the DNA. Residues protruding from the edge strand of the beta-pleated sheet and the following loop and strand contact the bases and backbone of both DNA strands, providing specificity for its DNA target site.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 9 0.0074 1.3e+02 4.0 0.0 26 56 7 37 3 49 0.82 2 9 0.0049 84 4.6 0.0 25 56 46 77 35 83 0.83 3 9 0.0031 52 5.2 0.1 24 56 65 97 52 109 0.75 4 9 0.0068 1.2e+02 4.1 0.1 25 56 86 117 76 123 0.82 5 9 0.0039 66 4.9 0.1 24 56 105 137 92 146 0.76 6 9 0.0047 80 4.6 0.3 24 56 125 157 114 168 0.78 7 9 0.0049 84 4.6 0.2 24 56 145 177 133 184 0.77 8 9 0.0046 79 4.6 0.2 24 56 165 197 154 207 0.78 9 9 0.0044 75 4.7 0.2 24 56 185 217 174 229 0.78
Sequence Information
- Coding Sequence
- ATGATTACTTATGAGCCCCACAAACTCGGTTTTGGTATTTGCTACACTAACAAAGCTAACAAAACAGTACTAGAGCCCCACAAACTCGGTTTTGGTATTTGCTACACTAACAAAGCTAACAAAACCGTACTAGAGCCCCACAAACTCGGTTTTGGTATTTACTACACTAACAAAGCTAACAAAACCGTACTAGAGCCCCACAAACTCGGTTTTGGTATTTGCTACACTAACAAAGCTAACAAAACAGTACTAGAGCCCCACAAACTCGGTTTTGGTATTTGCTACACTAACAAAGCTAACAAAACCGTACTAGAGCCCCACAAACTCGGTTTTGGTATTTGCTACACTAACAAAGCTAACAAAACAGTACTAGAGCCCCACAAACTCGGTTTTGGTATTTGCTACACTAACAAAGCTAACAAAACCGTACTAGAGCCCCACAAACTCGGTTTTGGTATTTGCTACACTAACAAAGCTAACAAAACAGTACTAGAGCCCCACAAACTCGGTTTTGGTATTTGCTACACTAACAAAGCTAACAAAACCGTACTAGAGCCCCACAAACTCGGTTTTGGTATTTGCTACACTAACAAAGCTAACAAAACAGTACTAGAGCCCCACAAACTCGGTTTTGGTATTTGCTACACTAACAAAGCTAACAAAACCGTACTAGAGCCCCACAAACTCGGTTTTGGATTTTACTACACTAACAAAACCGTACTATAG
- Protein Sequence
- MITYEPHKLGFGICYTNKANKTVLEPHKLGFGICYTNKANKTVLEPHKLGFGIYYTNKANKTVLEPHKLGFGICYTNKANKTVLEPHKLGFGICYTNKANKTVLEPHKLGFGICYTNKANKTVLEPHKLGFGICYTNKANKTVLEPHKLGFGICYTNKANKTVLEPHKLGFGICYTNKANKTVLEPHKLGFGICYTNKANKTVLEPHKLGFGICYTNKANKTVLEPHKLGFGFYYTNKTVL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -