Basic Information

Insect: Agelastica alni
Gene Symbol: -
Assembly: GCA_950111635.2
Location: OX467708.1:12407817-12408692[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.084 21 7.5 0.2 2 13 28 39 27 43 0.88

2 9 0.14 34 6.8 4.6 1 23 54 77 54 77 0.95

3 9 0.0066 1.6 11.0 0.4 1 23 83 105 83 105 0.81

4 9 3.3e-05 0.008 18.2 0.3 1 23 111 134 111 134 0.93

5 9 0.48 1.2e+02 5.1 4.1 2 23 147 168 146 169 0.87

6 9 1.7e-05 0.0042 19.1 0.4 3 23 180 200 179 200 0.98

7 9 0.00012 0.029 16.5 0.6 1 20 206 225 206 228 0.91

8 9 0.00035 0.086 15.0 4.6 1 23 234 256 234 256 0.97

9 9 0.00051 0.12 14.5 4.5 1 23 262 285 262 285 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.084	21	7.5	0.2	2	13	28	39	27	43	0.88
2	9	0.14	34	6.8	4.6	1	23	54	77	54	77	0.95
3	9	0.0066	1.6	11.0	0.4	1	23	83	105	83	105	0.81
4	9	3.3e-05	0.008	18.2	0.3	1	23	111	134	111	134	0.93
5	9	0.48	1.2e+02	5.1	4.1	2	23	147	168	146	169	0.87
6	9	1.7e-05	0.0042	19.1	0.4	3	23	180	200	179	200	0.98
7	9	0.00012	0.029	16.5	0.6	1	20	206	225	206	228	0.91
8	9	0.00035	0.086	15.0	4.6	1	23	234	256	234	256	0.97
9	9	0.00051	0.12	14.5	4.5	1	23	262	285	262	285	0.96

Sequence Information

Coding Sequence: ATGAGGGGCATCCTGGCTAAAATTAAATTCGACGAATACGATCAGTACATCGTTAAACCTGCCGAGTTGGAGGAGCCCTTGACGTGTGACAAATGCGATGCTACTTTCACAAACAACTTGGATTTCGGCTTCCACTCGATAGAACACAATAAAGACCTGTACGCGTGTCACATTTGCGGTGAATATGAACACAAAAAGAAATCCTCGCTGGAAAAGCACATTCGCGACCACGAAGGTATACGAAAATACAAATGCCCGATGTGCGACAAGCAATTCGCCGCCATCAAAACGGCATACGAACACCAATACGTGCACAGCGATCAGAAACCGTTCGAATGCGACGTTTGCGGCAAAAAATTCGCCACGTCGGCCTCGGCGAAGAATCACAAGAACGATCTGCACTACGAAATCGTCACAGGACGAAAATTGGAGAAATTCGATTGCATAACGTGCGGCAAACATTATGCCAACTACGCTGGATTGGCCCACCACAATTTCCGTCATCACAAAGAATTGTGCAGACTGATGCCGGCGCTGTGCGACATTTGCGGCATGAATTTTTCCAGTCGGGCGAAATTGAGGAAGCACGAGGCTACGCACAGCGTCGAGCGACCGCACGCGTGTCGCACGTGCTCGAAAACTTTTGCACGTGCCGGTGATCTGAGGCAACACCAACCGGTACACACGGGGGAAAAAAAGTACGCATGCAATTATTGCGGCAAGAGATTCGCTCATTATTCCCCATATCATTACCATTTGAAGTTACACACGGGGGAGAAACCGCACTCGTGTTTGATGTGTGGCAAAGGGTACATTTCGGTGGGTAATTTGAAGCATCACTTGAAGAGTTGTCACAAATCTTTGAATGATACTTAA
Protein Sequence: MRGILAKIKFDEYDQYIVKPAELEEPLTCDKCDATFTNNLDFGFHSIEHNKDLYACHICGEYEHKKKSSLEKHIRDHEGIRKYKCPMCDKQFAAIKTAYEHQYVHSDQKPFECDVCGKKFATSASAKNHKNDLHYEIVTGRKLEKFDCITCGKHYANYAGLAHHNFRHHKELCRLMPALCDICGMNFSSRAKLRKHEATHSVERPHACRTCSKTFARAGDLRQHQPVHTGEKKYACNYCGKRFAHYSPYHYHLKLHTGEKPHSCLMCGKGYISVGNLKHHLKSCHKSLNDT

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -