Basic Information

Transcription Factor Domain

TF Family: zf-GATA
Domain: zf-GATA domain
PFAM: PF00320
TF Group: Zinc-Coordinating Group
Description: This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contain a single copy of the domain.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.25 4e+02 0.9 1.9 1 11 11 21 11 22 0.90

2 7 0.017 28 4.6 0.0 3 14 43 54 42 54 0.91

3 7 0.012 19 5.2 0.0 3 14 54 65 53 73 0.88

4 7 0.014 23 4.9 0.0 3 14 102 113 101 115 0.91

5 7 0.86 1.4e+03 -0.8 0.0 4 13 114 123 112 124 0.87

6 7 0.0094 15 5.5 0.2 3 15 137 149 136 153 0.88

7 7 0.0086 14 5.6 0.0 3 14 171 182 170 183 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.25	4e+02	0.9	1.9	1	11	11	21	11	22	0.90
2	7	0.017	28	4.6	0.0	3	14	43	54	42	54	0.91
3	7	0.012	19	5.2	0.0	3	14	54	65	53	73	0.88
4	7	0.014	23	4.9	0.0	3	14	102	113	101	115	0.91
5	7	0.86	1.4e+03	-0.8	0.0	4	13	114	123	112	124	0.87
6	7	0.0094	15	5.5	0.2	3	15	137	149	136	153	0.88
7	7	0.0086	14	5.6	0.0	3	14	171	182	170	183	0.91

Coding Sequence: ATGCTTACTAGGCCAGTGCTGTTTCTATGTTGCCCTTGCTGCTACACCCTTACTACGCCACTACTATCGGTGCTAAGTCTTTGCCCACCGTTGCTACACCTGATACTACGCCACTACTACGTCGCTCGCTGCTACGTTGCTACTACGCCGCTACTACGTCGCTGCTACGTTGCTACTACGCCGCTACTACGCCGGTACTATGTCGCTGCTACGTCGCTGCTACGTCCTTACTACGCCACTACTATCGCTGCTACGTCTTTGCCCACTGTTGCTACACTGATACAACGCCACTACTACGTCGCTCGCTGCTACGTTGCTACTACGCCGCTACTACGTCGCTGCTACATCACTGCTACGTCGCTGCTACGTCCTTACTACGCCACCACTGTCGCTGCTGTCTTTGCCCATCGTTGCTACAATGATACTACGCCACTACTACGTCGCTCGCTGCTACTTTGCTACTACGCCGCTATTACGTCACTGCTACGTCGGTGCTACGTCTTTGCCCACCGTTGCTACGCTGATACTACGCCCCTACTACGCCGCTTGCTGCTACTTTGCTACTACGCCGCTACTACTTCGCTGCGATGCCACCGCTACACCCACCGCAATTGTGTATATTTTTACAATTGA
Protein Sequence: MLTRPVLFLCCPCCYTLTTPLLSVLSLCPPLLHLILRHYYVARCYVATTPLLRRCYVATTPLLRRYYVAATSLLRPYYATTIAATSLPTVATLIQRHYYVARCYVATTPLLRRCYITATSLLRPYYATTVAAVFAHRCYNDTTPLLRRSLLLCYYAAITSLLRRCYVFAHRCYADTTPLLRRLLLLCYYAATTSLRCHRYTHRNCVYFYN

Sequence clustering based on sequence similarity using MMseqs2