Acer025538.1
Basic Information
- Insect
- Abscondita cerata
- Gene Symbol
- Cebpg_1
- Assembly
- GCA_030710515.1
- Location
- JALBCR010000695.1:183595-184004[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 1.9 1.2e+04 -1.3 0.1 14 23 1 10 1 15 0.73 2 2 4.5e-15 2.9e-11 45.5 5.6 2 65 20 83 19 83 0.95
Sequence Information
- Coding Sequence
- ATGGCTCCTAAAAaaggaagaagtagaaagaataGTGAGCCAGCTTCAGGAGATGACTCTGATGAATATAGAAAAAAACGTGATCGCAACAATCTCgCTGTGAAACGAAGTCGGATCAAATCAAAACAGAAAACTCAAGAGACTGTAAATCGGGTTACtcaattaaaaagtgaaaattctGTATTAgaggaaaaagttaaaaatctcACAAAAGAGTTGGGATTCCTTAAAGAACTATTTTTGGCACATGCCAGCAGTACAACAGACGCATCCAAATTTCAAGGAATTGATCTACAAAGGTTGTTATCCGATAATCCTGATGGTAGCAGTACAAGTAATGACAATAACAATTCATCGTAA
- Protein Sequence
- MAPKKGRSRKNSEPASGDDSDEYRKKRDRNNLAVKRSRIKSKQKTQETVNRVTQLKSENSVLEEKVKNLTKELGFLKELFLAHASSTTDASKFQGIDLQRLLSDNPDGSSTSNDNNNSS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00853701; iTF_01515237; iTF_01284010; iTF_00152012;
- 90% Identity
- -
- 80% Identity
- -